PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV34032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family B3
Protein Properties Length: 535aa    MW: 61352.4 Da    PI: 4.1576
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV34032.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B331.14.3e-107405386
                EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
          B3 53 rkksgryvltkGWkeFvkangLkegDfvvFkldg 86
                ++ ++  ++tkGW++Fvk+n Lk+gD +vF +  
  KZV34032.1  7 ENAGKYWYFTKGWERFVKDNALKAGDCLVFDYFA 40
                55566679**********************9864 PP

2B334.73.2e-114315131296
                 HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
          B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                 ++g l +p + +++h+++ +++ +++l d++gr+++ k++ +k ++ ++ +kGW+   k n +   D ++ ++++ ++++l+++v
  KZV34032.1 431 RKGDLFIPTELITDHQMDMPKP-EMRLIDPHGRVFKGKYKKWKDGR-TLYSKGWRTLWKVNCISGDDYCICEFHQGEDGKLYLQV 513
                 56779**********8888888.9***************9888875.56789********************9888999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100179.97E-8149No hitNo description
PROSITE profilePS5086312.294152IPR003340B3 DNA binding domain
SuperFamilySSF1019362.75E-11256IPR015300DNA-binding pseudobarrel domain
PfamPF023622.0E-7740IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.4E-101257IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.37E-13417517IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.8E-11417516IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508637.993420519IPR003340B3 DNA binding domain
SMARTSM010190.0035422515IPR003340B3 DNA binding domain
PfamPF023621.5E-8429513IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MWCVMPENAG KYWYFTKGWE RFVKDNALKA GDCLVFDYFA KDVLDFKILG SNRCEKVGAR  60
EVLYIADDSS EDENLDDLPD DVGSEDEEEE WDDDDFCGEL DDDCWEEEGR GLFMKQEPKS  120
EGDDDDHHCG GNYDDVTVKQ QPKHEQGVSF SVKQESKSEV DDDVCMEKED EEDDHSLFVK  180
KEPKSEGDND ASVGIFKELG VKKEPKQEGD DDSGDDVENL VNHNNVVCVK IETEDEGDDG  240
CLGQDHLHPD DEYVENHRYH NNDEVLVESE HQHEGDGGGN EDLGDYADDD AHTDIENHDN  300
MIRRNSLQIS GGADIENDDY AFVEEEPPSE AYTDDFDHYS DDDEEVENDA DHGGYDDEET  360
DEADLMLSQG NEPEEYAQQS ANKGKLFLFG TKRKRHRASL FPRYYGLHIF ELGLARRPSN  420
PFFITHVSPR RKGDLFIPTE LITDHQMDMP KPEMRLIDPH GRVFKGKYKK WKDGRTLYSK  480
GWRTLWKVNC ISGDDYCICE FHQGEDGKLY LQVHIIYING GPPIRTPKRI EAKAK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10912264
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60142.11e-07B3 family protein